SCOP 1.61: Domain d1h88c3: 1h88 C:144-190

Lineage for d1h88c3 (1h88 C:144-190)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.1: Homeodomain-like [46689] (10 families)

5. Family a.4.1.3: Myb [46739] (4 proteins)

6. Protein c-Myb, DNA-binding domain [46740] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [46742] (12 PDB entries)

8. Domain d1h88c3: 1h88 C:144-190 [65723]
   Other proteins in same PDB: d1h88a_, d1h88b_

Details for d1h88c3

PDB Entry: 1h88, 2.8 Å

PDB Description: crystal structure of ternary protein-dna complex1

SCOP Domain Sequences for d1h88c3:

Sequence; same for both SEQRES and ATOM records:

>d1h88c3 a.4.1.3 (C:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
ktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmr

Timeline for d1h88c3:

• d1h88c3 first appeared in SCOP 1.59
  
• d1h88c3 appears in SCOP 1.63
  
• d1h88c3 appears in the current release, SCOPe 2.08