Lineage for d1h88c1 (1h88 C:39-88)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 210246Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 210247Superfamily a.4.1: Homeodomain-like [46689] (11 families) (S)
    consists only of helices
  5. 210389Family a.4.1.3: Myb [46739] (4 proteins)
  6. 210394Protein c-Myb, DNA-binding domain [46740] (2 species)
    duplication
  7. 210397Species Mouse (Mus musculus) [TaxId:10090] [46742] (12 PDB entries)
  8. 210398Domain d1h88c1: 1h88 C:39-88 [65721]
    Other proteins in same PDB: d1h88a_, d1h88b_

Details for d1h88c1

PDB Entry: 1h88 (more details), 2.8 Å

PDB Description: crystal structure of ternary protein-dna complex1

SCOP Domain Sequences for d1h88c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h88c1 a.4.1.3 (C:39-88) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
gktrwtreedeklkklveqngtddwkvianylpnrtdvqcqhrwqkvlnp

SCOP Domain Coordinates for d1h88c1:

Click to download the PDB-style file with coordinates for d1h88c1.
(The format of our PDB-style files is described here.)

Timeline for d1h88c1: