SCOPe 2.01: Domain d1h74d1: 1h74 D:5-167

Lineage for d1h74d1 (1h74 D:5-167)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (6 proteins)

6. Protein Homoserine kinase [54233] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [54234] (5 PDB entries)

8. Domain d1h74d1: 1h74 D:5-167 [65697]
   Other proteins in same PDB: d1h74a2, d1h74b2, d1h74c2, d1h74d2
   complexed with adp, ile, mg, sap

Details for d1h74d1

PDB Entry: 1h74, 1.9 Å

PDB Description: crystal structure of homoserine kinase complexed with ile

PDB Compounds: (D:) homoserine kinase

SCOPe Domain Sequences for d1h74d1:

Sequence; same for both SEQRES and ATOM records:

>d1h74d1 d.14.1.5 (D:5-167) Homoserine kinase {Methanococcus jannaschii [TaxId: 2190]}
mkvrvkapctsanlgvgfdvfglclkepydvieveaiddkeiiievddkniptdpdknva
givakkmiddfnigkgvkitikkgvkagsglgssaassagtayainelfklnldklklvd
yasygelassgakhadnvapaifggftmvtnyeplevlhipid

Timeline for d1h74d1:

• d1h74d1 first appeared in SCOP 1.59
  
• d1h74d1 appears in SCOP 1.75
  
• d1h74d1 appears in SCOPe 2.02
  
• d1h74d1 appears in the current release, SCOPe 2.08