SCOP 1.71: Domain d1h6aa2: 1h6a A:213-374

Lineage for d1h6aa2 (1h6a A:213-374)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (5 proteins)
   has many additional secondary structures

6. Protein Glucose-fructose oxidoreductase [55377] (1 species)
   very similar to the glucose 6-phosphate dehydrogenase domain

7. Species Zymomonas mobilis [TaxId:542] [55378] (6 PDB entries)

8. Domain d1h6aa2: 1h6a A:213-374 [65645]
   Other proteins in same PDB: d1h6aa1, d1h6ab1

Details for d1h6aa2

PDB Entry: 1h6a, 2.5 Å

PDB Description: reduced precursor form of glucose-fructose oxidoreductase from zymomonas mobilis

SCOP Domain Sequences for d1h6aa2:

Sequence; same for both SEQRES and ATOM records:

>d1h6aa2 d.81.1.5 (A:213-374) Glucose-fructose oxidoreductase {Zymomonas mobilis}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

Timeline for d1h6aa2:

• d1h6aa2 first appeared in SCOP 1.59
  
• d1h6aa2 appears in SCOP 1.69
  
• d1h6aa2 appears in SCOP 1.73
  
• d1h6aa2 appears in the current release, SCOPe 2.08