Lineage for d1h6aa2 (1h6a A:213-374)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135038Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 135039Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 135207Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (2 proteins)
  6. 135229Protein Glucose-fructose oxidoreductase [55377] (1 species)
  7. 135230Species Zymomonas mobilis [TaxId:542] [55378] (6 PDB entries)
  8. 135245Domain d1h6aa2: 1h6a A:213-374 [65645]
    Other proteins in same PDB: d1h6aa1, d1h6ab1

Details for d1h6aa2

PDB Entry: 1h6a (more details), 2.5 Å

PDB Description: reduced precursor form of glucose-fructose oxidoreductase from zymomonas mobilis

SCOP Domain Sequences for d1h6aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6aa2 d.81.1.5 (A:213-374) Glucose-fructose oxidoreductase {Zymomonas mobilis}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

SCOP Domain Coordinates for d1h6aa2:

Click to download the PDB-style file with coordinates for d1h6aa2.
(The format of our PDB-style files is described here.)

Timeline for d1h6aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h6aa1