Lineage for d1h5yb_ (1h5y B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1337250Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1337251Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 1337252Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)
  7. 1337262Species Pyrobaculum aerophilum [TaxId:13773] [69380] (1 PDB entry)
  8. 1337264Domain d1h5yb_: 1h5y B: [65639]
    complexed with gol, po4

Details for d1h5yb_

PDB Entry: 1h5y (more details), 2 Å

PDB Description: hisf protein from pyrobaculum aerophilum
PDB Compounds: (B:) hisf

SCOPe Domain Sequences for d1h5yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5yb_ c.1.2.1 (B:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Pyrobaculum aerophilum [TaxId: 13773]}
shmalriipcldidggakvvvkgvnfqgirevgdpvemavryeeegadeiailditaape
gratfidsvkrvaeavsipvlvgggvrsledattlfragadkvsvntaavrnpqlvalla
refgsqstvvaidakwngeyyevyvkggreatgldavkwakeveelgageilltsidrdg
tglgydvelirrvadsvripviasggagrvehfyeaaaagadavlaaslfhfrvlsiaqv
krylkergvevri

SCOPe Domain Coordinates for d1h5yb_:

Click to download the PDB-style file with coordinates for d1h5yb_.
(The format of our PDB-style files is described here.)

Timeline for d1h5yb_: