Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins) structural evidence for the gene duplication within the barrel fold automatically mapped to Pfam PF00977 |
Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species) |
Species Pyrobaculum aerophilum [TaxId:13773] [69380] (1 PDB entry) |
Domain d1h5yb_: 1h5y B: [65639] complexed with gol, po4 |
PDB Entry: 1h5y (more details), 2 Å
SCOPe Domain Sequences for d1h5yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h5yb_ c.1.2.1 (B:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Pyrobaculum aerophilum [TaxId: 13773]} shmalriipcldidggakvvvkgvnfqgirevgdpvemavryeeegadeiailditaape gratfidsvkrvaeavsipvlvgggvrsledattlfragadkvsvntaavrnpqlvalla refgsqstvvaidakwngeyyevyvkggreatgldavkwakeveelgageilltsidrdg tglgydvelirrvadsvripviasggagrvehfyeaaaagadavlaaslfhfrvlsiaqv krylkergvevri
Timeline for d1h5yb_: