SCOPe 2.08: Domain d1h5yb_: 1h5y B:

Lineage for d1h5yb_ (1h5y B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold
   automatically mapped to Pfam PF00977

6. Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [69380] (1 PDB entry)

8. Domain d1h5yb_: 1h5y B: [65639]
   complexed with gol, po4

Details for d1h5yb_

PDB Entry: 1h5y, 2 Å

PDB Description: hisf protein from pyrobaculum aerophilum

PDB Compounds: (B:) hisf

SCOPe Domain Sequences for d1h5yb_:

Sequence; same for both SEQRES and ATOM records:

>d1h5yb_ c.1.2.1 (B:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Pyrobaculum aerophilum [TaxId: 13773]}
shmalriipcldidggakvvvkgvnfqgirevgdpvemavryeeegadeiailditaape
gratfidsvkrvaeavsipvlvgggvrsledattlfragadkvsvntaavrnpqlvalla
refgsqstvvaidakwngeyyevyvkggreatgldavkwakeveelgageilltsidrdg
tglgydvelirrvadsvripviasggagrvehfyeaaaagadavlaaslfhfrvlsiaqv
krylkergvevri

Timeline for d1h5yb_:

• d1h5yb_ first appeared in SCOP 1.59
  
• d1h5yb_ appears in SCOPe 2.07