SCOP 1.69: Domain d1h5yb_: 1h5y B:

Lineage for d1h5yb_ (1h5y B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (2 proteins)
   structural evidence for the gene duplication within the barrel fold

6. Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [69380] (1 PDB entry)

8. Domain d1h5yb_: 1h5y B: [65639]

Details for d1h5yb_

PDB Entry: 1h5y, 2 Å

PDB Description: hisf protein from pyrobaculum aerophilum

SCOP Domain Sequences for d1h5yb_:

Sequence; same for both SEQRES and ATOM records:

>d1h5yb_ c.1.2.1 (B:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum}
shmalriipcldidggakvvvkgvnfqgirevgdpvemavryeeegadeiailditaape
gratfidsvkrvaeavsipvlvgggvrsledattlfragadkvsvntaavrnpqlvalla
refgsqstvvaidakwngeyyevyvkggreatgldavkwakeveelgageilltsidrdg
tglgydvelirrvadsvripviasggagrvehfyeaaaagadavlaaslfhfrvlsiaqv
krylkergvevri

Timeline for d1h5yb_:

• d1h5yb_ first appeared in SCOP 1.59
  
• d1h5yb_ appears in SCOP 1.67
  
• d1h5yb_ appears in SCOP 1.71
  
• d1h5yb_ appears in the current release, SCOPe 2.08