Lineage for d1h5rc_ (1h5r C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2505843Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2505844Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2506034Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 2506053Protein RmlA (RfbA) [53465] (5 species)
  7. 2506071Species Escherichia coli [TaxId:562] [69568] (3 PDB entries)
  8. 2506078Domain d1h5rc_: 1h5r C: [65625]
    complexed with g1p, so4, thm

Details for d1h5rc_

PDB Entry: 1h5r (more details), 1.9 Å

PDB Description: thymidylyltransferase complexed with thimidine and glucose-1-phospate
PDB Compounds: (C:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d1h5rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5rc_ c.68.1.6 (C:) RmlA (RfbA) {Escherichia coli [TaxId: 562]}
kmrkgiilaggsgtrlypvtmavskqllpiydkpmiyyplstlmlagirdiliistpqdt
prfqqllgdgsqwglnlqykvqpspdglaqafiigeefiggddcalvlgdnifyghdlpk
lmeaavnkesgatvfayhvndperygvvefdkngtaisleekplepksnyavtglyfydn
dvvqmaknlkpsargeleitdinriyleqgrlsvammgrgyawldtgthqslieasnfia
tieerqglkvscpeeiafrkgfidveqvrklavpliknnygqylykmtkd

SCOPe Domain Coordinates for d1h5rc_:

Click to download the PDB-style file with coordinates for d1h5rc_.
(The format of our PDB-style files is described here.)

Timeline for d1h5rc_: