SCOP 1.63: Domain d1gvca_: 1gvc A:

Lineage for d1gvca_ (1gvc A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (3 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Ovotransferrin [53894] (2 species)

7. Species Duck (Anas platyrhynchos) [TaxId:8839] [53895] (5 PDB entries)

8. Domain d1gvca_: 1gvc A: [65607]
   domain II in the N-terminal lobe
   complexed with co3, fe, nta

Details for d1gvca_

PDB Entry: 1gvc, 1.9 Å

PDB Description: 18kda n-ii domain fragment of duck ovotransferrin + nta

SCOP Domain Sequences for d1gvca_:

Sequence; same for both SEQRES and ATOM records:

>d1gvca_ c.94.1.2 (A:) Ovotransferrin {Duck (Anas platyrhynchos)}
syyavavvkkgtdfmikdlrgktschtglgrsagwnipigtlihrgdiewegiesgsveq
avakffsascvpgatteqklcrqckgdaktkclrnapysgysgafqclkdgkgdvafvkh
ttvqenapeekdeyellcldgtrqpvdsyktcnwarv

Timeline for d1gvca_:

• d1gvca_ first appeared in SCOP 1.59
  
• d1gvca_ appears in SCOP 1.61
  
• d1gvca_ appears in SCOP 1.65
  
• d1gvca_ appears in the current release, SCOPe 2.08