Lineage for d1gv0b2 (1gv0 B:143-305)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1938965Protein Malate dehydrogenase [56329] (12 species)
  7. 1938970Species Chlorobium tepidum [TaxId:1097] [69841] (1 PDB entry)
  8. 1938972Domain d1gv0b2: 1gv0 B:143-305 [65597]
    Other proteins in same PDB: d1gv0a1, d1gv0b1
    complexed with nad

Details for d1gv0b2

PDB Entry: 1gv0 (more details), 2.5 Å

PDB Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1gv0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gv0b2 d.162.1.1 (B:143-305) Malate dehydrogenase {Chlorobium tepidum [TaxId: 1097]}
agvldsarfrsfiamelgvsmqdvtacvlgghgdamvpvvkyttvagipvadlisaeria
elvertrtggaeivnhlkqgsafyspatsvvemvesivldrkrvltcavsldgqygidgt
fvgvpvklgkngvehiyeikldqsdldllqksakivdenckml

SCOPe Domain Coordinates for d1gv0b2:

Click to download the PDB-style file with coordinates for d1gv0b2.
(The format of our PDB-style files is described here.)

Timeline for d1gv0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gv0b1