Lineage for d1gv0b2 (1gv0 B:143-305)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198275Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)
  4. 198276Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) (S)
  5. 198277Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
  6. 198338Protein Malate dehydrogenase [56329] (10 species)
  7. 198350Species Chlorobium tepidum [TaxId:1097] [69841] (1 PDB entry)
  8. 198352Domain d1gv0b2: 1gv0 B:143-305 [65597]
    Other proteins in same PDB: d1gv0a1, d1gv0b1

Details for d1gv0b2

PDB Entry: 1gv0 (more details), 2.5 Å

PDB Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases

SCOP Domain Sequences for d1gv0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gv0b2 d.162.1.1 (B:143-305) Malate dehydrogenase {Chlorobium tepidum}
agvldsarfrsfiamelgvsmqdvtacvlgghgdamvpvvkyttvagipvadlisaeria
elvertrtggaeivnhlkqgsafyspatsvvemvesivldrkrvltcavsldgqygidgt
fvgvpvklgkngvehiyeikldqsdldllqksakivdenckml

SCOP Domain Coordinates for d1gv0b2:

Click to download the PDB-style file with coordinates for d1gv0b2.
(The format of our PDB-style files is described here.)

Timeline for d1gv0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gv0b1