SCOP 1.69: Domain d1gsxa_: 1gsx A:

Lineage for d1gsxa_ (1gsx A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.110: Profilin-like [55769] (7 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (6 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (27 PDB entries)

8. Domain d1gsxa_: 1gsx A: [65539]

Details for d1gsxa_

PDB Entry: 1gsx, 1.79 Å

PDB Description: crystal structure of the p65 crystal form of photoactive yellow protein g47s/g51s mutant

SCOP Domain Sequences for d1gsxa_:

Sequence; same for both SEQRES and ATOM records:

>d1gsxa_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
vafgsedientlakmddgqldglafgaiqldgdgnilqynaaesditsrdpkqvigknff
kdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvk
rv

Timeline for d1gsxa_:

• d1gsxa_ first appeared in SCOP 1.59
  
• d1gsxa_ appears in SCOP 1.67
  
• d1gsxa_ appears in SCOP 1.71
  
• d1gsxa_ appears in the current release, SCOPe 2.08