SCOP 1.59: Domain d1gsxa_: 1gsx A:

Lineage for d1gsxa_ (1gsx A:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.110: Profilin-like [55769] (4 superfamilies)

4. Superfamily d.110.3: PYP-like sensor domain [55785] (4 families)

5. Family d.110.3.1: Photoactive yellow protein, PYP [55786] (1 protein)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (11 PDB entries)

8. Domain d1gsxa_: 1gsx A: [65539]

Details for d1gsxa_

PDB Entry: 1gsx, 1.79 Å

PDB Description: crystal structure of the p65 crystal form of photoactive yellow protein g47s/g51s mutant

SCOP Domain Sequences for d1gsxa_:

Sequence; same for both SEQRES and ATOM records:

>d1gsxa_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Ectothiorhodospira halophila}
vafgsedientlakmddgqldglafgaiqldgdgnilqynaaesditsrdpkqvigknff
kdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvk
rv

Timeline for d1gsxa_:

• d1gsxa_ is new in SCOP 1.59
  
• d1gsxa_ appears in SCOP 1.61
  
• d1gsxa_ appears in the current release, SCOPe 2.08