SCOP 1.67: Domain d1gpwe_: 1gpw E:

Lineage for d1gpwe_ (1gpw E:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (2 proteins)
   structural evidence for the gene duplication within the barrel fold

6. Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)

7. Species Thermotoga maritima [TaxId:243274] [51371] (3 PDB entries)

8. Domain d1gpwe_: 1gpw E: [65464]
   Other proteins in same PDB: d1gpwb_, d1gpwd_, d1gpwf_
   complexed with po4; mutant

Details for d1gpwe_

PDB Entry: 1gpw, 2.4 Å

PDB Description: structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex.

SCOP Domain Sequences for d1gpwe_:

Sequence, based on SEQRES records:

>d1gpwe_ c.1.2.1 (E:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima}
mlakriiaclnvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk
tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
lkkhgvnvrlegl

Sequence, based on observed residues (ATOM records):

>d1gpwe_ c.1.2.1 (E:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima}
mlakriiaclnvkdgrvvknfenlrdsgdpvelgkfyseigidelvflditasvekrktm
lelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfgs
qavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksgy
dtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeylk
khgvnvrlegl

Timeline for d1gpwe_:

• d1gpwe_ first appeared in SCOP 1.59
  
• d1gpwe_ appears in SCOP 1.65
  
• d1gpwe_ appears in SCOP 1.69
  
• d1gpwe_ appears in the current release, SCOPe 2.08