![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
![]() | Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [69448] (5 PDB entries) |
![]() | Domain d1gpwb_: 1gpw B: [65461] Other proteins in same PDB: d1gpwa_, d1gpwc_, d1gpwe_ complexed with po4 |
PDB Entry: 1gpw (more details), 2.4 Å
SCOPe Domain Sequences for d1gpwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpwb_ c.23.16.1 (B:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe ksskigrkllekviecslsr
Timeline for d1gpwb_: