Lineage for d1gpwa_ (1gpw A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 172806Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 172807Family c.1.2.1: Histidine biosynthesis enzymes [51367] (2 proteins)
  6. 172808Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (3 species)
  7. 172815Species Thermotoga maritima [TaxId:243274] [51371] (2 PDB entries)
  8. 172817Domain d1gpwa_: 1gpw A: [65460]
    Other proteins in same PDB: d1gpwb_, d1gpwd_, d1gpwf_

Details for d1gpwa_

PDB Entry: 1gpw (more details), 2.4 Å

PDB Description: structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex.

SCOP Domain Sequences for d1gpwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpwa_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima}
mlakriiaclnvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk
tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
lkkhgvnvrlegl

SCOP Domain Coordinates for d1gpwa_:

Click to download the PDB-style file with coordinates for d1gpwa_.
(The format of our PDB-style files is described here.)

Timeline for d1gpwa_: