Lineage for d1gpia_ (1gpi A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119246Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
  6. 1119247Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)
  7. 1119248Species Basidomycetes fungus (Phanerochaete chrysosporium), Cel7d [TaxId:5306] [69239] (2 PDB entries)
  8. 1119249Domain d1gpia_: 1gpi A: [65450]
    complexed with nag

Details for d1gpia_

PDB Entry: 1gpi (more details), 1.32 Å

PDB Description: cellobiohydrolase cel7d (cbh 58) from phanerochaete chrysosporium. catalytic module at 1.32 angstrom resolution
PDB Compounds: (A:) exoglucanase I

SCOPe Domain Sequences for d1gpia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpia_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Basidomycetes fungus (Phanerochaete chrysosporium), Cel7d [TaxId: 5306]}
eqagtntaenhpqlqsqqcttsggckplstkvvldsnwrwvhstsgytncytgnewdtsl
cpdgktcaancaldgadysgtygitstgtaltlkfvtgsnvgsrvylmaddthyqllkll
nqeftfdvdmsnlpcglngalylsamdadggmskypgnkagakygtgycdsqcpkdikfi
ngeanvgnwtetgsntgtgsygtccsemdiweanndaaaftphpctttgqtrcsgddcar
ntglcdgdgcdfnsfrmgdktflgkgmtvdtskpftvvtqfltndntstgtlseirriyi
qngkviqnsvanipgvdpvnsitdnfcaqqktafgdtnwfaqkgglkqmgealgngmvla
lsiwddhaanmlwldsdyptdkdpsapgvargtcattsgvpsdvesqvpnsqvvfsnikf
gdigstfsgts

SCOPe Domain Coordinates for d1gpia_:

Click to download the PDB-style file with coordinates for d1gpia_.
(The format of our PDB-style files is described here.)

Timeline for d1gpia_: