SCOPe 2.06: Domain d1gp9b2: 1gp9 B:126-208

Lineage for d1gp9b2 (1gp9 B:126-208)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57458] (18 PDB entries)

8. Domain d1gp9b2: 1gp9 B:126-208 [65445]
   Other proteins in same PDB: d1gp9a1, d1gp9b1, d1gp9c1, d1gp9d1
   complexed with epe

Details for d1gp9b2

PDB Entry: 1gp9, 2.5 Å

PDB Description: a new crystal form of the nk1 splice variant of hgf/sf demonstrates extensive hinge movement and suggests that the nk1 dimer originates by domain swapping

PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d1gp9b2:

Sequence; same for both SEQRES and ATOM records:

>d1gp9b2 g.14.1.1 (B:126-208) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcse

Timeline for d1gp9b2:

• d1gp9b2 first appeared in SCOP 1.59
  
• d1gp9b2 appears in SCOPe 2.05
  
• d1gp9b2 appears in SCOPe 2.07
  
• d1gp9b2 appears in the current release, SCOPe 2.08