Class g: Small proteins [56992] (94 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (3 families) |
Family g.14.1.1: Kringle modules [57441] (7 proteins) |
Protein NK1 fragment of hepatocyte growth factor [57457] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57458] (18 PDB entries) |
Domain d1gp9b2: 1gp9 B:126-208 [65445] Other proteins in same PDB: d1gp9a1, d1gp9b1, d1gp9c1, d1gp9d1 complexed with epe |
PDB Entry: 1gp9 (more details), 2.5 Å
SCOPe Domain Sequences for d1gp9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gp9b2 g.14.1.1 (B:126-208) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg gpwcftsnpevryevcdipqcse
Timeline for d1gp9b2: