SCOPe 2.07: Domain d1gmwb2: 1gmw B:71-138

Lineage for d1gmwb2 (1gmw B:71-138)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.38: Urease metallochaperone UreE, C-terminal domain [69737] (1 family)
   automatically mapped to Pfam PF05194

5. Family d.58.38.1: Urease metallochaperone UreE, C-terminal domain [69738] (2 proteins)

6. Protein Urease metallochaperone UreE, C-terminal domain [69739] (2 species)

7. Species Klebsiella aerogenes [TaxId:28451] [69740] (3 PDB entries)

8. Domain d1gmwb2: 1gmw B:71-138 [65350]
   Other proteins in same PDB: d1gmwa1, d1gmwb1, d1gmwc1, d1gmwd1
   complexed with cu

Details for d1gmwb2

PDB Entry: 1gmw, 1.5 Å

PDB Description: structure of uree

PDB Compounds: (B:) uree

SCOPe Domain Sequences for d1gmwb2:

Sequence; same for both SEQRES and ATOM records:

>d1gmwb2 d.58.38.1 (B:71-138) Urease metallochaperone UreE, C-terminal domain {Klebsiella aerogenes [TaxId: 28451]}
deevsvvrcddpfmlakacyalgnrhvplqimpgelryhhdhvlddmlrqfgltvtfgql
pfepeaga

Timeline for d1gmwb2:

• d1gmwb2 first appeared in SCOP 1.59
  
• d1gmwb2 appears in SCOPe 2.06
  
• d1gmwb2 appears in the current release, SCOPe 2.08