Lineage for d1gmua1 (1gmu A:1-70)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 172621Fold b.107: Urease metallochaperone UreE, N-terminal domain [69286] (1 superfamily)
  4. 172622Superfamily b.107.1: Urease metallochaperone UreE, N-terminal domain [69287] (1 family) (S)
  5. 172623Family b.107.1.1: Urease metallochaperone UreE, N-terminal domain [69288] (1 protein)
  6. 172624Protein Urease metallochaperone UreE, N-terminal domain [69289] (2 species)
  7. 172628Species Klebsiella aerogenes [TaxId:28451] [69290] (3 PDB entries)
  8. 172629Domain d1gmua1: 1gmu A:1-70 [65335]
    Other proteins in same PDB: d1gmua2, d1gmub2, d1gmuc2, d1gmud2

Details for d1gmua1

PDB Entry: 1gmu (more details), 1.5 Å

PDB Description: structure of uree

SCOP Domain Sequences for d1gmua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmua1 b.107.1.1 (A:1-70) Urease metallochaperone UreE, N-terminal domain {Klebsiella aerogenes}
mlyltqrleipaaatasvtlpidvrvksrvkvtlndgrdaglllprglllrggdvlsnee
gtefvqviaa

SCOP Domain Coordinates for d1gmua1:

Click to download the PDB-style file with coordinates for d1gmua1.
(The format of our PDB-style files is described here.)

Timeline for d1gmua1: