Class g: Small proteins [56992] (90 folds) |
Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily) alpha+beta fold with two crossing loops |
Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern |
Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins) automatically mapped to Pfam PF00024 |
Protein Hepatocyte growth factor [57416] (1 species) heparin-binding domain |
Species Human (Homo sapiens) [TaxId:9606] [57417] (9 PDB entries) |
Domain d1gmof1: 1gmo F:37-125 [65329] Other proteins in same PDB: d1gmoa2, d1gmob2, d1gmoc2, d1gmod2, d1gmoe2, d1gmof2, d1gmog2, d1gmoh2 complexed with epe, so4 |
PDB Entry: 1gmo (more details), 3 Å
SCOPe Domain Sequences for d1gmof1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gmof1 g.10.1.1 (F:37-125) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} ntihefkksakttlikidpalkiktkkvntadqcadrctrnkglpftckafvfdkarkqc lwfpfnsmssgvkkefghefdlyenkdyi
Timeline for d1gmof1: