Class g: Small proteins [56992] (90 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (2 families) |
Family g.14.1.1: Kringle modules [57441] (7 proteins) |
Protein NK1 fragment of hepatocyte growth factor [57457] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57458] (6 PDB entries) |
Domain d1gmod2: 1gmo D:126-208 [65326] Other proteins in same PDB: d1gmoa1, d1gmob1, d1gmoc1, d1gmod1, d1gmoe1, d1gmof1, d1gmog1, d1gmoh1 complexed with epe, so4 |
PDB Entry: 1gmo (more details), 3 Å
SCOPe Domain Sequences for d1gmod2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gmod2 g.14.1.1 (D:126-208) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg gpwcftsnpevryevcdipqcse
Timeline for d1gmod2: