Lineage for d1gmof1 (1gmo F:37-125)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 203748Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
  4. 203749Superfamily g.10.1: Hairpin loop containing domain-like [57414] (2 families) (S)
  5. 203750Family g.10.1.1: Hairpin loop containing domain [57415] (1 protein)
  6. 203751Protein Hepatocyte growth factor [57416] (1 species)
  7. 203752Species Human (Homo sapiens) [TaxId:9606] [57417] (6 PDB entries)
  8. 203768Domain d1gmof1: 1gmo F:37-125 [65329]
    Other proteins in same PDB: d1gmoa2, d1gmob2, d1gmoc2, d1gmod2, d1gmoe2, d1gmof2, d1gmog2, d1gmoh2

Details for d1gmof1

PDB Entry: 1gmo (more details), 3 Å

PDB Description: crystal structures of nk1-heparin complexes reveal the basis for nk1 activity and enable engineering of potent agonists of the met receptor

SCOP Domain Sequences for d1gmof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmof1 g.10.1.1 (F:37-125) Hepatocyte growth factor {Human (Homo sapiens)}
ntihefkksakttlikidpalkiktkkvntadqcadrctrnkglpftckafvfdkarkqc
lwfpfnsmssgvkkefghefdlyenkdyi

SCOP Domain Coordinates for d1gmof1:

Click to download the PDB-style file with coordinates for d1gmof1.
(The format of our PDB-style files is described here.)

Timeline for d1gmof1: