SCOP 1.63: Domain d1gmoc1: 1gmo C:37-125

Lineage for d1gmoc1 (1gmo C:37-125)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulphide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (1 protein)

6. Protein Hepatocyte growth factor [57416] (1 species)
   heparin-binding domain

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (6 PDB entries)

8. Domain d1gmoc1: 1gmo C:37-125 [65323]
   Other proteins in same PDB: d1gmoa2, d1gmob2, d1gmoc2, d1gmod2, d1gmoe2, d1gmof2, d1gmog2, d1gmoh2

Details for d1gmoc1

PDB Entry: 1gmo, 3 Å

PDB Description: crystal structures of nk1-heparin complexes reveal the basis for nk1 activity and enable engineering of potent agonists of the met receptor

SCOP Domain Sequences for d1gmoc1:

Sequence; same for both SEQRES and ATOM records:

>d1gmoc1 g.10.1.1 (C:37-125) Hepatocyte growth factor {Human (Homo sapiens)}
ntihefkksakttlikidpalkiktkkvntadqcadrctrnkglpftckafvfdkarkqc
lwfpfnsmssgvkkefghefdlyenkdyi

Timeline for d1gmoc1:

• d1gmoc1 first appeared in SCOP 1.59
  
• d1gmoc1 appears in SCOP 1.61
  
• d1gmoc1 appears in SCOP 1.65
  
• d1gmoc1 appears in the current release, SCOPe 2.08