SCOP 1.59: Domain d1gmoa1: 1gmo A:37-125

Lineage for d1gmoa1 (1gmo A:37-125)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (2 families)

5. Family g.10.1.1: Hairpin loop containing domain [57415] (1 protein)

6. Protein Hepatocyte growth factor [57416] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (6 PDB entries)

8. Domain d1gmoa1: 1gmo A:37-125 [65319]
   Other proteins in same PDB: d1gmoa2, d1gmob2, d1gmoc2, d1gmod2, d1gmoe2, d1gmof2, d1gmog2, d1gmoh2

Details for d1gmoa1

PDB Entry: 1gmo, 3 Å

PDB Description: crystal structures of nk1-heparin complexes reveal the basis for nk1 activity and enable engineering of potent agonists of the met receptor

SCOP Domain Sequences for d1gmoa1:

Sequence; same for both SEQRES and ATOM records:

>d1gmoa1 g.10.1.1 (A:37-125) Hepatocyte growth factor {Human (Homo sapiens)}
ntihefkksakttlikidpalkiktkkvntadqcadrctrnkglpftckafvfdkarkqc
lwfpfnsmssgvkkefghefdlyenkdyi

Timeline for d1gmoa1:

• d1gmoa1 is new in SCOP 1.59
  
• d1gmoa1 appears in SCOP 1.61
  
• d1gmoa1 appears in the current release, SCOPe 2.08