SCOP 1.63: Domain d1gmnb1: 1gmn B:42-125

Lineage for d1gmnb1 (1gmn B:42-125)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulphide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (1 protein)

6. Protein Hepatocyte growth factor [57416] (1 species)
   heparin-binding domain

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (6 PDB entries)

8. Domain d1gmnb1: 1gmn B:42-125 [65317]
   Other proteins in same PDB: d1gmna2, d1gmnb2
   complexed with epe, ids, sgn; mutant

Details for d1gmnb1

PDB Entry: 1gmn, 2.3 Å

PDB Description: crystal structures of nk1-heparin complexes reveal the basis for nk1 activity and enable engineering of potent agonists of the met receptor

SCOP Domain Sequences for d1gmnb1:

Sequence, based on SEQRES records:

>d1gmnb1 g.10.1.1 (B:42-125) Hepatocyte growth factor {Human (Homo sapiens)}
fkksakttlikidpalkiktkkvntadqcadrctrnkglpftckafvfdkarkqclwfpf
nsmssgvkkefghefdlyenkdyi

Sequence, based on observed residues (ATOM records):

>d1gmnb1 g.10.1.1 (B:42-125) Hepatocyte growth factor {Human (Homo sapiens)}
fkksakttlickafwfpfnsmlyenkdyi

Timeline for d1gmnb1:

• d1gmnb1 first appeared in SCOP 1.59
  
• d1gmnb1 appears in SCOP 1.61
  
• d1gmnb1 appears in SCOP 1.65
  
• d1gmnb1 appears in the current release, SCOPe 2.08