Lineage for d1gmna2 (1gmn A:126-207)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260117Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2260118Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2260119Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2260136Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 2260137Species Human (Homo sapiens) [TaxId:9606] [57458] (18 PDB entries)
  8. 2260152Domain d1gmna2: 1gmn A:126-207 [65316]
    Other proteins in same PDB: d1gmna1, d1gmnb1
    complexed with epe

Details for d1gmna2

PDB Entry: 1gmn (more details), 2.3 Å

PDB Description: crystal structures of nk1-heparin complexes reveal the basis for nk1 activity and enable engineering of potent agonists of the met receptor
PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d1gmna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gmna2 g.14.1.1 (A:126-207) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcs

SCOPe Domain Coordinates for d1gmna2:

Click to download the PDB-style file with coordinates for d1gmna2.
(The format of our PDB-style files is described here.)

Timeline for d1gmna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gmna1