Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species) |
Species Escherichia coli [TaxId:562] [55362] (4 PDB entries) Uniprot P00353 |
Domain d1gl3b2: 1gl3 B:134-354 [65285] Other proteins in same PDB: d1gl3a1, d1gl3b1 complexed with cys, ndp |
PDB Entry: 1gl3 (more details), 2.6 Å
SCOPe Domain Sequences for d1gl3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gl3b2 d.81.1.1 (B:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} nctvslmlmslgglfandlvdwvsvatyqaasgggarhmrelltqmghlyghvadelatp ssaildierkvttltrsgelpvdnfgvplagslipwidkqldngqsreewkgqaetnkil ntssvipvdglcvrvgalrchsqaftiklkkdvsiptveellaahnpwakvvpndreitm reltpaavtgtlttpvgrlrklnmgpeflsaftvgdqllwg
Timeline for d1gl3b2: