![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins) |
![]() | Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50523] (51 PDB entries) |
![]() | Domain d1gl1c_: 1gl1 C: [65274] Other proteins in same PDB: d1gl1i_, d1gl1j_, d1gl1k_ |
PDB Entry: 1gl1 (more details), 2.1 Å
SCOP Domain Sequences for d1gl1c_:
Sequence, based on SEQRES records: (download)
>d1gl1c_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)} cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq tlaan
>d1gl1c_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)} cgvpaiqpvlsgivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl psasddfaagttcvttgwgltryntpdrlqqaslpllsntnckkywgtkikdamicagas gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
Timeline for d1gl1c_: