SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1gl1c_ (1gl1 C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2055878Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 2055879Species Cow (Bos taurus) [TaxId:9913] [50523] (59 PDB entries)
    Uniprot P00766
  8. 2055931Domain d1gl1c_: 1gl1 C: [65274]
    Other proteins in same PDB: d1gl1i_, d1gl1j_, d1gl1k_
    complexed with cd

Details for d1gl1c_

PDB Entry: 1gl1 (more details), 2.1 Å

PDB Description: structure of the complex between bovine alpha-chymotrypsin and pmp-c, an inhibitor from the insect locusta migratoria
PDB Compounds: (C:) alpha-chymotrypsin

SCOPe Domain Sequences for d1gl1c_:

Sequence, based on SEQRES records: (download)

>d1gl1c_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d1gl1c_ b.47.1.2 (C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsgivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryntpdrlqqaslpllsntnckkywgtkikdamicagas
gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOPe Domain Coordinates for d1gl1c_:

Click to download the PDB-style file with coordinates for d1gl1c_.
(The format of our PDB-style files is described here.)

Timeline for d1gl1c_: