Lineage for d1gklb_ (1gkl B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1616235Family c.69.1.2: Carboxylesterase [53487] (7 proteins)
  6. 1616263Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species)
  7. 1616264Species Clostridium thermocellum [TaxId:1515] [69580] (5 PDB entries)
  8. 1616266Domain d1gklb_: 1gkl B: [65251]
    complexed with act, cd, fer, gol; mutant

Details for d1gklb_

PDB Entry: 1gkl (more details), 1.4 Å

PDB Description: s954a mutant of the feruloyl esterase module from clostridium thermocellum complexed with ferulic acid
PDB Compounds: (B:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d1gklb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gklb_ c.69.1.2 (B:) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh

SCOPe Domain Coordinates for d1gklb_:

Click to download the PDB-style file with coordinates for d1gklb_.
(The format of our PDB-style files is described here.)

Timeline for d1gklb_: