SCOP 1.71: Domain d1gkla_: 1gkl A:

Lineage for d1gkla_ (1gkl A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (4 proteins)

6. Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [69580] (2 PDB entries)

8. Domain d1gkla_: 1gkl A: [65250]

Details for d1gkla_

PDB Entry: 1gkl, 1.4 Å

PDB Description: s954a mutant of the feruloyl esterase module from clostridium thermocellum complexed with ferulic acid

SCOP Domain Sequences for d1gkla_:

Sequence; same for both SEQRES and ATOM records:

>d1gkla_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh

Timeline for d1gkla_:

• d1gkla_ first appeared in SCOP 1.59
  
• d1gkla_ appears in SCOP 1.69
  
• d1gkla_ appears in SCOP 1.73
  
• d1gkla_ appears in the current release, SCOPe 2.08, called d1gkla1