Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.2: Carboxylesterase [53487] (4 proteins) |
Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species) |
Species Clostridium thermocellum [TaxId:1515] [69580] (2 PDB entries) |
Domain d1gkla_: 1gkl A: [65250] |
PDB Entry: 1gkl (more details), 1.4 Å
SCOP Domain Sequences for d1gkla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gkla_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum} sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
Timeline for d1gkla_: