SCOPe 2.08: Domain d1gkla1: 1gkl A:803-1077

Lineage for d1gkla1 (1gkl A:803-1077)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (7 proteins)

6. Protein Feruloyl esterase domain of the cellulosomal xylanase y [69579] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [69580] (5 PDB entries)

8. Domain d1gkla1: 1gkl A:803-1077 [65250]
   Other proteins in same PDB: d1gkla2, d1gklb2
   complexed with act, cd, fer, gol; mutant

Details for d1gkla1

PDB Entry: 1gkl, 1.4 Å

PDB Description: s954a mutant of the feruloyl esterase module from clostridium thermocellum complexed with ferulic acid

PDB Compounds: (A:) endo-1,4-beta-xylanase y

SCOPe Domain Sequences for d1gkla1:

Sequence; same for both SEQRES and ATOM records:

>d1gkla1 c.69.1.2 (A:803-1077) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}
sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw
ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
fskgnfyflvapgathwwgyvrhyiydalpyffhe

Timeline for d1gkla1:

• d1gkla1 first appeared in SCOP 1.59, called d1gkla_
  
• d1gkla1 appears in SCOPe 2.07