Class g: Small proteins [56992] (72 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families) |
Family g.39.1.2: Nuclear receptor [57721] (11 proteins) duplication: two zinc-binding motifs |
Protein Orphan nuclear receptor reverb DNA-binding domain [57734] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57735] (3 PDB entries) |
Domain d1ga5f_: 1ga5 F: [65176] complexed with 5it, zn |
PDB Entry: 1ga5 (more details), 2.4 Å
SCOP Domain Sequences for d1ga5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ga5f_ g.39.1.2 (F:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens)} vllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinrnrcqqc rfkkclsvgmsrdavrfg
Timeline for d1ga5f_: