SCOP 1.63: Domain d1ga5f_: 1ga5 F:

Lineage for d1ga5f_ (1ga5 F:)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families)

5. Family g.39.1.2: Nuclear receptor [57721] (8 proteins)
   duplication: two zinc-binding motifs

6. Protein Orphan nuclear receptor reverb [57734] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57735] (3 PDB entries)

8. Domain d1ga5f_: 1ga5 F: [65176]
   complexed with 5it, zn

Details for d1ga5f_

PDB Entry: 1ga5, 2.4 Å

PDB Description: crystal structure of the orphan nuclear receptor rev-erb(alpha) dna- binding domain bound to its cognate response element

SCOP Domain Sequences for d1ga5f_:

Sequence; same for both SEQRES and ATOM records:

>d1ga5f_ g.39.1.2 (F:) Orphan nuclear receptor reverb {Human (Homo sapiens)}
vllckvcgdvasgfhygvlacegckgffrrsiqqniqykrclknencsivrinrnrcqqc
rfkkclsvgmsrdavrfg

Timeline for d1ga5f_:

• d1ga5f_ first appeared in SCOP 1.59
  
• d1ga5f_ appears in SCOP 1.61
  
• d1ga5f_ appears in SCOP 1.65
  
• d1ga5f_ appears in the current release, SCOPe 2.08