Lineage for d1g3ya3 (1g3y A:148-225)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120543Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 1120583Family b.34.1.2: FeoA-like [50041] (4 proteins)
  6. 1120584Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 1120585Species Corynebacterium diphtheriae [TaxId:1717] [50043] (15 PDB entries)
    Uniprot P33120
  8. 1120596Domain d1g3ya3: 1g3y A:148-225 [65138]
    Other proteins in same PDB: d1g3ya1, d1g3ya2
    complexed with zn

Details for d1g3ya3

PDB Entry: 1g3y (more details), 2.8 Å

PDB Description: arg80ala dtxr
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1g3ya3:

Sequence, based on SEQRES records: (download)

>d1g3ya3 b.34.1.2 (A:148-225) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtiriee

Sequence, based on observed residues (ATOM records): (download)

>d1g3ya3 b.34.1.2 (A:148-225) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaamprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngkdv
ellddlahtiriee

SCOPe Domain Coordinates for d1g3ya3:

Click to download the PDB-style file with coordinates for d1g3ya3.
(The format of our PDB-style files is described here.)

Timeline for d1g3ya3: