| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) ![]() |
| Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins) |
| Protein Diphtheria toxin repressor (DtxR) [47981] (1 species) |
| Species Corynebacterium diphtheriae [TaxId:1717] [47982] (15 PDB entries) |
| Domain d1g3ya2: 1g3y A:65-140 [65137] Other proteins in same PDB: d1g3ya1, d1g3ya3 complexed with zn; mutant |
PDB Entry: 1g3y (more details), 2.8 Å
SCOP Domain Sequences for d1g3ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g3ya2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhalaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv
Timeline for d1g3ya2: