Lineage for d1g1sb2 (1g1s B:119-157)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701322Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1701323Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1701419Protein E-selectin, EGF-domain [57203] (1 species)
  7. 1701420Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries)
  8. 1701423Domain d1g1sb2: 1g1s B:119-157 [65103]
    Other proteins in same PDB: d1g1sa1, d1g1sb1
    complexed with mrd, na, sr

Details for d1g1sb2

PDB Entry: 1g1s (more details), 1.9 Å

PDB Description: p-selectin lectin/egf domains complexed with psgl-1 peptide
PDB Compounds: (B:) p-selectin

SCOPe Domain Sequences for d1g1sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1sb2 g.3.11.1 (B:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}
tascqdmscskqgecletignytcscypgfygpeceyvr

SCOPe Domain Coordinates for d1g1sb2:

Click to download the PDB-style file with coordinates for d1g1sb2.
(The format of our PDB-style files is described here.)

Timeline for d1g1sb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g1sb1