Lineage for d1g1oc_ (1g1o C:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) 
Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein) Protein Transthyretin (synonym: prealbumin) [49474] (3 species) Species Human (Homo sapiens) [TaxId:9606] [49475] (40 PDB entries) 
Domain d1g1oc_: 1g1o C: [65082]
Details for d1g1oc_
PDB Entry: 1g1o (more details), 2.3 Å
PDB Description: crystal structure of the highly amyloidogenic transthyretin mutant ttr g53s/e54d/l55s
SCOP Domain Sequences for d1g1oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1oc_ b.3.4.1 (C:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
lmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltteeefvegiykv
eidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
SCOP Domain Coordinates for d1g1oc_:
Click to download the PDB-style file with coordinates for d1g1oc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g1oc_:
- d1g1oc_ is new in SCOP 1.59
- d1g1oc_ appears in SCOP 1.61
- d1g1oc_ appears in the current release, SCOPe 2.08
View in 3D
