Lineage for d1g05b_ (1g05 B:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins) 
Protein Stromelysin-1 (MMP-3) [55536] (1 species) Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (28 PDB entries) 
Domain d1g05b_: 1g05 B: [65077]
Details for d1g05b_
PDB Entry: 1g05 (more details), 2.45 Å
PDB Description: heterocycle-based mmp inhibitor with p2'substituents
SCOP Domain Sequences for d1g05b_:
Sequence, based on SEQRES records: (download)
>d1g05b_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet
Sequence, based on observed residues (ATOM records): (download)
>d1g05b_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhfrlsqddingiqslygpppdspet
SCOP Domain Coordinates for d1g05b_:
Click to download the PDB-style file with coordinates for d1g05b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g05b_:
- d1g05b_ is new in SCOP 1.59
- d1g05b_ appears in SCOP 1.61
- d1g05b_ appears in the current release, SCOPe 2.08
View in 3D
