Lineage for d1fj0a_ (1fj0 A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149460Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 149461Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 149462Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 149466Protein Cytochrome c2 [46650] (8 species)
  7. 149485Species Rhodopseudomonas palustris [TaxId:1076] [46655] (4 PDB entries)
  8. 149488Domain d1fj0a_: 1fj0 A: [65011]

Details for d1fj0a_

PDB Entry: 1fj0 (more details), 1.7 Å

PDB Description: structure determination of the ferricytochrome c2 from rhodopseudomonas palustris

SCOP Domain Sequences for d1fj0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj0a_ a.3.1.1 (A:) Cytochrome c2 {Rhodopseudomonas palustris}
edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk

SCOP Domain Coordinates for d1fj0a_:

Click to download the PDB-style file with coordinates for d1fj0a_.
(The format of our PDB-style files is described here.)

Timeline for d1fj0a_: