Lineage for d1f9nc1 (1f9n C:2-78)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306414Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (2 proteins)
    automatically mapped to Pfam PF01316
  6. 2306415Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species)
  7. 2306423Species Bacillus subtilis [TaxId:1423] [68966] (3 PDB entries)
  8. 2306431Domain d1f9nc1: 1f9n C:2-78 [64994]
    Other proteins in same PDB: d1f9na2, d1f9nb2, d1f9nc2, d1f9nd2, d1f9ne2, d1f9nf2

Details for d1f9nc1

PDB Entry: 1f9n (more details), 2.7 Å

PDB Description: crystal structure of ahrc, the arginine repressor/activator protein from bacillus subtilis
PDB Compounds: (C:) arginine repressor/activator protein

SCOPe Domain Sequences for d1f9nc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9nc1 a.4.5.3 (C:2-78) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus subtilis [TaxId: 1423]}
nkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsyk
yslpadqrfnplsklkr

SCOPe Domain Coordinates for d1f9nc1:

Click to download the PDB-style file with coordinates for d1f9nc1.
(The format of our PDB-style files is described here.)

Timeline for d1f9nc1: