Lineage for d1f3xe2 (1f3x E:12-115,E:218-395)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2446508Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2446509Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 2446510Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 2446563Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (7 PDB entries)
  8. 2446600Domain d1f3xe2: 1f3x E:12-115,E:218-395 [64971]
    Other proteins in same PDB: d1f3xa1, d1f3xa3, d1f3xb1, d1f3xb3, d1f3xc1, d1f3xc3, d1f3xd1, d1f3xd3, d1f3xe1, d1f3xe3, d1f3xf1, d1f3xf3, d1f3xg1, d1f3xg3, d1f3xh1, d1f3xh3
    complexed with k, mn, pyr; mutant

Details for d1f3xe2

PDB Entry: 1f3x (more details), 2.8 Å

PDB Description: s402p mutant of rabbit muscle pyruvate kinase
PDB Compounds: (E:) pyruvate kinase

SCOPe Domain Sequences for d1f3xe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3xe2 c.1.12.1 (E:12-115,E:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe

SCOPe Domain Coordinates for d1f3xe2:

Click to download the PDB-style file with coordinates for d1f3xe2.
(The format of our PDB-style files is described here.)

Timeline for d1f3xe2: