| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) ![]() |
| Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) automatically mapped to Pfam PF02887 |
| Protein Pyruvate kinase, C-terminal domain [52937] (6 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (7 PDB entries) |
| Domain d1f3xb3: 1f3x B:396-530 [64963] Other proteins in same PDB: d1f3xa1, d1f3xa2, d1f3xb1, d1f3xb2, d1f3xc1, d1f3xc2, d1f3xd1, d1f3xd2, d1f3xe1, d1f3xe2, d1f3xf1, d1f3xf2, d1f3xg1, d1f3xg2, d1f3xh1, d1f3xh2 complexed with k, mn, pyr; mutant |
PDB Entry: 1f3x (more details), 2.8 Å
SCOPe Domain Sequences for d1f3xb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3xb3 c.49.1.1 (B:396-530) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
elarasphstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwr
pgsgftntmrvvpvp
Timeline for d1f3xb3: