Lineage for d1f3wa2 (1f3w A:12-115,A:218-395)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088021Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 2088022Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 2088072Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (7 PDB entries)
  8. 2088114Domain d1f3wa2: 1f3w A:12-115,A:218-395 [64935]
    Other proteins in same PDB: d1f3wa1, d1f3wa3, d1f3wb1, d1f3wb3, d1f3wc1, d1f3wc3, d1f3wd1, d1f3wd3, d1f3we1, d1f3we3, d1f3wf1, d1f3wf3, d1f3wg1, d1f3wg3, d1f3wh1, d1f3wh3
    complexed with k, mn, pyr

Details for d1f3wa2

PDB Entry: 1f3w (more details), 3 Å

PDB Description: recombinant rabbit muscle pyruvate kinase
PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d1f3wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3wa2 c.1.12.1 (A:12-115,A:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe

SCOPe Domain Coordinates for d1f3wa2:

Click to download the PDB-style file with coordinates for d1f3wa2.
(The format of our PDB-style files is described here.)

Timeline for d1f3wa2: