| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (18 species) |
| Species Lactobacillus pentosus [TaxId:1589] [69418] (1 PDB entry) |
| Domain d1ez4d1: 1ez4 D:16-162 [64923] Other proteins in same PDB: d1ez4a2, d1ez4b2, d1ez4c2, d1ez4d2 complexed with nad |
PDB Entry: 1ez4 (more details), 2.3 Å
SCOPe Domain Sequences for d1ez4d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ez4d1 c.2.1.5 (D:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]}
smpnhqkvvlvgdgavgssyafamaqqgiaeefvivdvvkdrtkgdaldledaqaftapk
kiysgeysdckdadlvvitagapqkpgesrldlvnknlnilssivkpvvdsgfdgiflva
anpvdiltyatwkfsgfpkervigsg
Timeline for d1ez4d1: