SCOPe 2.07: Domain d1ey3f_: 1ey3 F:

Lineage for d1ey3f_ (1ey3 F:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.3: Crotonase-like [52103] (14 proteins)

6. Protein Enoyl-CoA hydratase (crotonase) [52106] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52107] (4 PDB entries)

8. Domain d1ey3f_: 1ey3 F: [64916]
   complexed with dak

Details for d1ey3f_

PDB Entry: 1ey3, 2.3 Å

PDB Description: structure of enoyl-coa hydratase complexed with the substrate dac-coa

PDB Compounds: (F:) enoyl-coa hydratase

SCOPe Domain Sequences for d1ey3f_:

Sequence; same for both SEQRES and ATOM records:

>d1ey3f_ c.14.1.3 (F:) Enoyl-CoA hydratase (crotonase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltggek
afaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcdii
yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
regmsafvekrkanfkdh

Timeline for d1ey3f_:

• d1ey3f_ first appeared in SCOP 1.59
  
• d1ey3f_ appears in SCOPe 2.06
  
• d1ey3f_ appears in the current release, SCOPe 2.08