Lineage for d1eq1a_ (1eq1 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 917704Fold a.63: Apolipophorin-III [47856] (1 superfamily)
    5 helices; bundle, closed, left-handed twist
  4. 917705Superfamily a.63.1: Apolipophorin-III [47857] (1 family) (S)
  5. 917706Family a.63.1.1: Apolipophorin-III [47858] (1 protein)
  6. 917707Protein Apolipophorin-III [47859] (2 species)
    five-helical bundle
    probably related to four-helical (apo)lipoproteins
  7. 917711Species Tobacco hornworm (Manduca sexta) [TaxId:7130] [69054] (1 PDB entry)
  8. 917712Domain d1eq1a_: 1eq1 A: [64910]

Details for d1eq1a_

PDB Entry: 1eq1 (more details)

PDB Description: nmr structure of an exchangeable apolipoprotein-manduca sexta apolipophorin-iii
PDB Compounds: (A:) apolipophorin-III

SCOPe Domain Sequences for d1eq1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eq1a_ a.63.1.1 (A:) Apolipophorin-III {Tobacco hornworm (Manduca sexta) [TaxId: 7130]}
dapaggnafeemekhakefqktfseqfnslvnskntqdfnkalkdgsdsvlqqlsafsss
lqgaisdangkakealeqarqnvektaeelrkahpdvekeanafkdklqaavqttvqesq
klakevasnmeetnkklapkikqayddfvkhaeevqkklheaatkq

SCOPe Domain Coordinates for d1eq1a_:

Click to download the PDB-style file with coordinates for d1eq1a_.
(The format of our PDB-style files is described here.)

Timeline for d1eq1a_: