| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.63: Apolipophorin-III [47856] (1 superfamily) 5 helices; bundle, closed, left-handed twist |
Superfamily a.63.1: Apolipophorin-III [47857] (1 family) ![]() |
| Family a.63.1.1: Apolipophorin-III [47858] (1 protein) |
| Protein Apolipophorin-III [47859] (2 species) five-helical bundle probably related to four-helical (apo)lipoproteins |
| Species Tobacco hornworm (Manduca sexta) [TaxId:7130] [69054] (1 PDB entry) |
| Domain d1eq1a_: 1eq1 A: [64910] |
PDB Entry: 1eq1 (more details)
SCOPe Domain Sequences for d1eq1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eq1a_ a.63.1.1 (A:) Apolipophorin-III {Tobacco hornworm (Manduca sexta) [TaxId: 7130]}
dapaggnafeemekhakefqktfseqfnslvnskntqdfnkalkdgsdsvlqqlsafsss
lqgaisdangkakealeqarqnvektaeelrkahpdvekeanafkdklqaavqttvqesq
klakevasnmeetnkklapkikqayddfvkhaeevqkklheaatkq
Timeline for d1eq1a_: