Lineage for d1eb9a_ (1eb9 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 184304Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 184305Superfamily c.69.1: alpha/beta-Hydrolases [53474] (23 families) (S)
  5. 184669Family c.69.1.20: Hydroxynitrile lyase [53585] (1 protein)
  6. 184670Protein Hydroxynitrile lyase [53586] (2 species)
  7. 184671Species Cassava (Manihot esculenta) [TaxId:3983] [53588] (7 PDB entries)
  8. 184678Domain d1eb9a_: 1eb9 A: [64898]

Details for d1eb9a_

PDB Entry: 1eb9 (more details), 2.1 Å

PDB Description: structure determinants of substrate specificity of hydroxynitrile lyase from manihot esculenta

SCOP Domain Sequences for d1eb9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eb9a_ c.69.1.20 (A:) Hydroxynitrile lyase {Cassava (Manihot esculenta)}
piskmvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfde
yseplltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsy
tvekllesfpdardteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrk
gslfqnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdh
klqltkteevahilqevadaya

SCOP Domain Coordinates for d1eb9a_:

Click to download the PDB-style file with coordinates for d1eb9a_.
(The format of our PDB-style files is described here.)

Timeline for d1eb9a_: